The domain within your query sequence starts at position 62 and ends at position 361; the E-value for the NAGidase domain shown below is 2.5e-84.
CGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLMT LISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMC AADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKL LPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRST ELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLEN
NAGidase |
![]() |
---|
PFAM accession number: | PF07555 |
---|---|
Interpro abstract (IPR011496): | This family consists of both eukaryotic and prokaryotic hyaluronidases. Human Q9HAR0 is expressed during meningioma [ (PUBMED:9811929) ]. Clostridium perfringens, P26831 is involved in pathogenesis and is likely to act on connectivity tissue during gas gangrene [ (PUBMED:8177218) ]. It catalyses the random hydrolysis of 1->4-linkages between N-acetyl-beta-D-glucosamine and D-glucuronate residues in hyaluronate. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGidase