The domain within your query sequence starts at position 726 and ends at position 936; the E-value for the NARG2_C domain shown below is 1.7e-85.
SEYIAPQEGNFVYKLFSLQDLLLLVRCSIQRVETRPRSKKRKKIRRQFPVYVLPKVEYQG CYGVEALTESELCRFWTESLLHSNCSFYVGHIDAFTSKLFMLEEIASEELKEKLAALKIS SLFNILQHILKKLCSLQEGSYLLSHAAEDSSLLIYKTSDGKVTRTAYNLHKAHCDLPGVP SSLSVPWVPLDPSYLLPYHIHHGRVPCTFPP
NARG2_C |
![]() |
---|
PFAM accession number: | PF10505 |
---|---|
Interpro abstract (IPR019535): | This entry represents the C-terminal of little elongation complex subunit 2 (ICE2, also known as NARG2). ICE2 is a component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III [ (PUBMED:23932780) (PUBMED:22195968) ]. This C-terminal domain belongs to the PD-(D/E)XK nuclease superfamily [ (PUBMED:22638584) ]. |
GO component: | transcription elongation factor complex (GO:0008023) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NARG2_C