The domain within your query sequence starts at position 37 and ends at position 314; the E-value for the NCU-G1 domain shown below is 3.3e-94.
ETRQLLEFDSTNASEGAQPPGKPYPPYSLAKFSWNNITNSLDLANLSADFQGRPVDDPTG AFANGSLTFKVQAFSRSGRPAQPPRLLHTADVCQLEVALVGASPRGNHSLFGLEVATLGQ GPDCPSVNERNSIDDEYAPAVFQLNQLLWGSSPSGFMQWRPVAFSEEERARESALPCQAS TLHSTLASSLPHSPIVQAFFGSQNNFCAFNLTFGAPTGPGYWDQYYLCWSMLLGMGFPPV DIFSPLVLGIMAVALGAPGLMFLGGGLFLLLRHRRYSE
NCU-G1 |
---|
PFAM accession number: | PF15065 |
---|---|
Interpro abstract (IPR029382): | NCU-G1 is a set of highly conserved nuclear proteins rich in proline with a molecular weight of approximately 44kDa. Especially high levels are detected in human prostate, liver and kidney. NCU-G1 is a dual-function family capable of functioning as a transcription factor as well as a nuclear receptor co-activator by stimulating the transcriptional activity of peroxisome proliferator-activated receptor-alpha (PPAR-alpha) [ (PUBMED:18021396) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCU-G1