SMART: Pfam domain NDT80

The domain within your query sequence starts at position 252 and ends at position 399; the E-value for the NDT80_PhoG domain shown below is 3.4e-29.

AFVCQKKNHFQITVHIQVWGSPKFVKTQVGLKPIEKFYLKAFGIKVEATNQVIAIEQSQA
DRSKKTFDPVKIDLLTDQVTKVTLGRLHFSETTANNMRKKGKPNPDQRYFMLVVGLYAAN
QDQFYLLAAHISERIIVRASNPGQFEND

NDT80_PhoG

PFAM accession number:	PF05224
Interpro abstract (IPR024061):	The NDT80 DNA-binding domain is found in the following proteins, which might all be involved in sensing nutritional status [ (PUBMED:16464624) ]: Yeast meiosis-specific transcription factor NDT80, the key transcription factor that ultimately allows the continuation of meiosis after the successful completion of recombination. Emericella nidulans phoG (xprG), a transcriptional activator involved in the response to nutrient limitation. Emericella nidulans putative uncharacterised protein AN6015.2. Neurospora crassa transcription factor vib-1, involved in the control of heterokaryon incompatibility. Neurospora crassa related to acid phosphatase NCU04729. Neurospora crassa related to meiosis-specific protein NDT80 NCU09915. The proteolytically resistant core NDT80 DNA-binding domain reveals a central beta-sandwich characteristic of an s-type Ig fold. The beta-sandwich contains a three-stranded sheet composed of strands a, b and e, packed against a four-stranded sheet composed of strands c', c, f and g. Each sheet of the beta-sandwich contains an additional beta-strand, as well as a variety of peripheral secondary structure elements. The NDT80 DNA-binding domain contains an N-terminal extension, which consists of a beta-hairpin and a loop [ (PUBMED:12411490) ].
GO function:	DNA binding (GO:0003677)

PFAM accession number:

PF05224

Interpro abstract (IPR024061):

The NDT80 DNA-binding domain is found in the following proteins, which might all be involved in sensing nutritional status [ (PUBMED:16464624) ]:

Yeast meiosis-specific transcription factor NDT80, the key transcription factor that ultimately allows the continuation of meiosis after the successful completion of recombination.
Emericella nidulans phoG (xprG), a transcriptional activator involved in the response to nutrient limitation.
Emericella nidulans putative uncharacterised protein AN6015.2.
Neurospora crassa transcription factor vib-1, involved in the control of heterokaryon incompatibility.
Neurospora crassa related to acid phosphatase NCU04729.
Neurospora crassa related to meiosis-specific protein NDT80 NCU09915.

The proteolytically resistant core NDT80 DNA-binding domain reveals a central beta-sandwich characteristic of an s-type Ig fold. The beta-sandwich contains a three-stranded sheet composed of strands a, b and e, packed against a four-stranded sheet composed of strands c', c, f and g. Each sheet of the beta-sandwich contains an additional beta-strand, as well as a variety of peripheral secondary structure elements. The NDT80 DNA-binding domain contains an N-terminal extension, which consists of a beta-hairpin and a loop [ (PUBMED:12411490) ].

GO function:

DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDT80_PhoG