The domain within your query sequence starts at position 393 and ends at position 540; the E-value for the NDT80_PhoG domain shown below is 7.6e-31.
AFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKLHGVKLEALNQSINIEQSQS
DRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQRYFMLVVALQAHA
QNQNYTLAAQISERIIVRASNPGQFESD
NDT80_PhoG |
|
---|
PFAM accession number: | PF05224 |
---|
Interpro abstract (IPR024061): |
The NDT80 DNA-binding domain is found in the following proteins, which might all be involved in sensing nutritional status [ (PUBMED:16464624) ]: - Yeast meiosis-specific transcription factor NDT80, the key transcription factor that ultimately allows the continuation of meiosis after the successful completion of recombination.
- Emericella nidulans phoG (xprG), a transcriptional activator involved in the response to nutrient limitation.
- Emericella nidulans putative uncharacterised protein AN6015.2.
- Neurospora crassa transcription factor vib-1, involved in the control of heterokaryon incompatibility.
- Neurospora crassa related to acid phosphatase NCU04729.
- Neurospora crassa related to meiosis-specific protein NDT80 NCU09915.
The proteolytically resistant core NDT80 DNA-binding domain reveals a central beta-sandwich characteristic of an s-type Ig fold. The beta-sandwich contains a three-stranded sheet composed of strands a, b and e, packed against a four-stranded sheet composed of strands c', c, f and g. Each sheet of the beta-sandwich contains an additional beta-strand, as well as a variety of peripheral secondary structure elements. The NDT80 DNA-binding domain contains an N-terminal extension, which consists of a beta-hairpin and a loop [ (PUBMED:12411490) ].
|
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDT80_PhoG