The domain within your query sequence starts at position 427 and ends at position 461; the E-value for the NDUFV3 domain shown below is 1.5e-18.
DTTTYKNLQHHDYNTYTFLDLNLDLSKFRLPQPSS
NDUFV3 |
![]() |
---|
PFAM accession number: | PF15880 |
---|---|
Interpro abstract (IPR026193): | NADH dehydrogenase [ubiquinone] flavoprotein 3 (NDUFV3) is a accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone [ (PUBMED:1902801) (PUBMED:1778979) ]. |
GO component: | mitochondrial respiratory chain complex I (GO:0005747), mitochondrion (GO:0005739) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUFV3