The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the NICE-3 domain shown below is 2.3e-34.
MASSSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKVATT I
NICE-3 |
---|
PFAM accession number: | PF07406 |
---|---|
Interpro abstract (IPR010876): | This family consists of several eukaryotic C1orf43 and related proteins. C1orf43 is also known as NICE-3. The gene encoding C1orf43 is part of the epidermal differentiation complex (EDC), which comprises a large number of genes that are of crucial importance for the maturation of the human epidermis [ (PUBMED:11230159) ]. The function of C1orf43 is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NICE-3