The domain within your query sequence starts at position 106 and ends at position 193; the E-value for the NID domain shown below is 7.3e-34.
ALITFEKEEVAQNVISMGNHVVQMEGTPVKVSAHPVPLNTGVRFQVHVDISKMKINVTGI PDELSEEQTRDKLELSFCKSRNGGGEVE
NID |
---|
PFAM accession number: | PF07292 |
---|---|
Interpro abstract (IPR009909): | This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi). This domain mediates Nmi-Nmi protein interactions and subcellular localisation [ (PUBMED:10950963) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NID