SMART: Pfam domain NMT

The domain within your query sequence starts at position 308 and ends at position 495; the E-value for the NMT_C domain shown below is 1.4e-85.

EVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMEKKDIPVVHQLLSRYLKQFHLTPVMN
QEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHT
QTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMG
AEKVGLVL

NMT_C

PFAM accession number:	PF02799
Interpro abstract (IPR022677):	Myristoyl-CoA:protein N-myristoyltransferase ( EC 2.3.1.97 ) (Nmt) [ (PUBMED:8322618) ] is the enzyme responsible for transferring a myristate group on the N-terminal glycine of a number of cellular eukaryotics and viral proteins. Nmt is a monomeric protein of about 50 to 60kDa whose sequence appears to be well conserved. The N and C-terminal domains of NMT are structurally similar, each adopting an acyl-CoA N-acyltransferase-like fold. This entry represents the C-terminal region.
GO function:	glycylpeptide N-tetradecanoyltransferase activity (GO:0004379)

PFAM accession number:

PF02799

Interpro abstract (IPR022677):

Myristoyl-CoA:protein N-myristoyltransferase ( EC 2.3.1.97 ) (Nmt) [ (PUBMED:8322618) ] is the enzyme responsible for transferring a myristate group on the N-terminal glycine of a number of cellular eukaryotics and viral proteins. Nmt is a monomeric protein of about 50 to 60kDa whose sequence appears to be well conserved.

The N and C-terminal domains of NMT are structurally similar, each adopting an acyl-CoA N-acyltransferase-like fold. This entry represents the C-terminal region.

GO function:

glycylpeptide N-tetradecanoyltransferase activity (GO:0004379)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NMT_C