The domain within your query sequence starts at position 1 and ends at position 60; the E-value for the NOP5NT domain shown below is 2.1e-23.

MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAVI

NOP5NT

• PFAM accession number: PF08156
• Interpro abstract (IPR012974):

  This N-terminal domain is found in RNA-binding proteins of the NOP5 family [ (PUBMED:15112237) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOP5NT