The domain within your query sequence starts at position 1 and ends at position 83; the E-value for the NOT2_3_5 domain shown below is 3.1e-25.
AQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQISVSLFIHSLTTFFPGQGTYI YFDYEKWGQRKKEGFTFEYRYLE
NOT2_3_5 |
 |
|---|
| PFAM accession number: | PF04153 |
|---|---|
| Interpro abstract (IPR007282): | NOT1, NOT2, NOT3, NOT4 and NOT5 form a nuclear complex that negatively regulates the basal and activated transcription of many genes [ (PUBMED:7926748) ]. This domain can be found in NOT2, NOT3 and NOT5. |
| GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOT2_3_5