The domain within your query sequence starts at position 345 and ends at position 472; the E-value for the NOT2_3_5 domain shown below is 2.5e-37.

LYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGD
VLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEF
HLEYDKLE

NOT2_3_5

• PFAM accession number: PF04153
• Interpro abstract (IPR007282):

  NOT1, NOT2, NOT3, NOT4 and NOT5 form a nuclear complex that negatively regulates the basal and activated transcription of many genes [ (PUBMED:7926748) ]. This domain can be found in NOT2, NOT3 and NOT5.

• GO process: regulation of transcription, DNA-templated (GO:0006355)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOT2_3_5