The domain within your query sequence starts at position 248 and ends at position 455; the E-value for the NPL4 domain shown below is 1.8e-87.
HFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRK VGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKF VTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYK DIDKFGNEITQLARPLPVEYLIIDDFHS
NPL4 |
---|
PFAM accession number: | PF05021 |
---|---|
Interpro abstract (IPR007717): | The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterised step in ER-associated degradation following ubiquitination of target proteins but preceding their recognition by the 26S proteasome [ (PUBMED:11739805) ]. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing [ (PUBMED:11574150) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPL4