The domain within your query sequence starts at position 136 and ends at position 183; the E-value for the NR_Repeat domain shown below is 3.4e-27.

FCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSV

NR_Repeat

NR_Repeat
PFAM accession number:PF14046
Interpro abstract (IPR025900):

This is a repeat involved in dimerisation of nuclear receptors proteins and in transcriptional regulation in general. It contains a Leu-Xaa-Xaa-Leu-Leu motif which has been characterised for the orphan nuclear receptor Dax-1, which represses the constitutively expressed protein Ad4BP/SF-1. The LXXLL motif plays in important role in binding of Dax-1 to Ad4BP/SF-1 [ (PUBMED:12482977) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NR_Repeat