The domain within your query sequence starts at position 62 and ends at position 113; the E-value for the NUC130_3NT domain shown below is 3.3e-28.
FMAQIGQCYPEHLSNFPQELKDLLSYNHTVLDPDLRMTFCKALILLRNKNLI
NUC130_3NT |
![]() |
---|
PFAM accession number: | PF08158 |
---|---|
Interpro abstract (IPR012977): | This N-terminal domain is found in a novel nucleolar protein family defined by NUC130/133 [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC130_3NT