The domain within your query sequence starts at position 62 and ends at position 113; the E-value for the NUC130_3NT domain shown below is 5.3e-24.

FMAQIGQCYPEHLSNFPQELKDLLSYNHTVLDPDLRMTFCKALILLRNKNLI

NUC130_3NT

NUC130_3NT
PFAM accession number:PF08158
Interpro abstract (IPR012977):

This N-terminal domain is found in a novel nucleolar protein family defined by NUC130/133 [ (PUBMED:15112237) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC130_3NT