The domain within your query sequence starts at position 200 and ends at position 243; the E-value for the NUC205 domain shown below is 7.3e-29.

EKSVKPNFTARVDGKFISLVSLSSDGCIYETLIPIYSSDTEQNQ

NUC205

 NUC205
PFAM accession number:PF08168
Interpro abstract (IPR012584):

This domain is found in a novel family of nucleolar proteins [ (PUBMED:15112237) ].

GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC205