The domain within your query sequence starts at position 200 and ends at position 243; the E-value for the NUC205 domain shown below is 7.3e-29.
EKSVKPNFTARVDGKFISLVSLSSDGCIYETLIPIYSSDTEQNQ
NUC205 |
![]() |
---|
PFAM accession number: | PF08168 |
---|---|
Interpro abstract (IPR012584): | This domain is found in a novel family of nucleolar proteins [ (PUBMED:15112237) ]. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC205