The domain within your query sequence starts at position 420 and ends at position 647; the E-value for the NYAP_C domain shown below is 7.7e-17.

TQSPHGYPKSHSTSPSPVSMGRSLTPLSLKRPPPYDAVHSGSLSRSSSSVPHTTPRPVSQ
DGAKMVNAAVNTYSAAQSGSRSRTPTSPLEELTSLFTSGRSLLRKSSSGRRSKEPAEKST
EELKVRSHSTEPLPKLDSKERGHYGSSSSREPVKAQEWDGTPGPPVVTSRMGRCSVSPTL
LAGNHSSEPKVSCKLGRSASTSGVPPPSVTPLRQASDLQQSQVPSSLA

NYAP_C

NYAP_C
PFAM accession number:PF15452
Interpro abstract (IPR029353):

This entry represents the C-terminal domain of the neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 1 (NYAP1). NYAP1 belongs to the neuronal tyrosine-phosphorylated adaptor for the PI 3-kinase (NYAP) family, which consists of NYAP1, NYAP2, NAP3/Myosin16. NYAPs activate PI3K in PI3K pathway, which is a fundamental pathway for various cellular events in neurons. They also interact with components of the WAVE1 complex, which mediates actin cytoskeleton remodeling through Arp2/3 complex. It was suggested that NYAPs connect PI3K activation to WAVE1 signalling in neurons [ (PUBMED:21946561) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NYAP_C