The domain within your query sequence starts at position 100 and ends at position 200; the E-value for the NYD-SP28 domain shown below is 1.7e-33.
AADVREIHRRVEEEETKRQRLEKLENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNS QQVHCAELIEDKNKLANELQQELKIKDDQYVKDLKKQSEDI
NYD-SP28 |
---|
PFAM accession number: | PF14772 |
---|---|
Interpro abstract (IPR039505): | This entry represents the N-terminal domain of dynein regulatory complex protein 1/2 (DRC1/2). DRC1 is a key component of the nexin-dynein regulatory complex (N-DRC), essential for N-DRC integrity. It is required for the assembly and regulation of specific classes of inner dynein arm motors. It may also function to restrict dynein-driven microtubule sliding, thus aiding in the generation of ciliary bending [ (PUBMED:23354437) ]. Mutations of DRC1 gene cause Ciliary dyskinesia, primary, 21 (CILD21), which is a disorder characterised by abnormalities of motile cilia [ (PUBMED:23354437) ]. DRC2, also known as CCDC65, is an essential component of the nexin-dynein regulatory complex [ (PUBMED:24094744) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NYD-SP28