The domain within your query sequence starts at position 36 and ends at position 304; the E-value for the N_Asn_amidohyd domain shown below is 1.3e-124.
QSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDG SDTKAEVPLIMSSIKSFSEHAECGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDKQDDDIH LVTLCVTELNDREENENHFPIIYGIAVNIKTAEIYRASFQDRGPEEQLRAARALAGGPMI SIYDAKTEQLRIGPCSWTPFPQVDFWLQQDDKQILESLSTSPLAEPPHFVEHIRSTLMFL KKFPSPENILFPGNKALLYKKNKDGLWEK
N_Asn_amidohyd |
![]() |
---|
PFAM accession number: | PF14736 |
---|---|
Interpro abstract (IPR026750): | Protein N-terminal asparagine amidohydrolase (NTAN1) acts on the side-chain deamidation of N-terminal asparagine residues to aspartate. It is required for the ubiquitin-dependent turnover of intracellular proteins that initiate with Met-Asn. These proteins are acetylated on the retained initiator methionine and can subsequently be modified by the removal of N-acetyl methionine by acylaminoacid hydrolase (AAH). Conversion of the resulting N-terminal asparagine to aspartate by PNAD renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. NTAN1 does not act on substrates with internal or C-terminal asparagines and does not act on glutamine residues in any position [ (PUBMED:8089117) (PUBMED:7814382) ]. |
GO function: | protein-N-terminal asparagine amidohydrolase activity (GO:0008418) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry N_Asn_amidohyd