The domain within your query sequence starts at position 378 and ends at position 479; the E-value for the N_BRCA1_IG domain shown below is 7.1e-34.
DENLPDGTHLQPGTKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKA GHVGVVSVEFIAPTLEGTYTSHWRLSHKGQQFGPRVWCSIIV
N_BRCA1_IG |
![]() |
---|
PFAM accession number: | PF16158 |
---|---|
Interpro abstract (IPR032350): | This domain is found between positions 365-485 in the human next to BRCA1 gene 1 protein Q14596 (NBR1_HUMAN). Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry N_BRCA1_IG