The domain within your query sequence starts at position 253 and ends at position 379; the E-value for the Na_Ca_ex_C domain shown below is 4.6e-57.
KRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGNFTPLEGKEVDES RREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKH AAEQAKK
Na_Ca_ex_C |
---|
PFAM accession number: | PF16494 |
---|---|
Interpro abstract (IPR032452): | This is a C-terminal extension of the eukaryote sodium/calcium exchanger domain, and is cytoplasmic. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_Ca_ex_C