The domain within your query sequence starts at position 109 and ends at position 509; the E-value for the Na_H_Exchanger domain shown below is 1.3e-89.

ISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLF
LLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQINNIGL
LDTLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFASYD
SVGISDIFLGFLSFFVVALGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLS
AELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVA
GSHQWNWTFVISTLLFCLIARVLGVLVLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFS
LGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDL

Na_H_Exchanger

Na_H_Exchanger
PFAM accession number:PF00999
Interpro abstract (IPR006153):

Sodium proton exchangers (NHEs) constitute a large family of integral membrane protein transporters that are responsible for the counter-transport of protons and sodium ions across lipid bilayers [ (PUBMED:12027219) (PUBMED:12502567) ]. These proteins are found in organisms across all domains of life. In archaea, bacteria, yeast and plants, these exchangers provide increased salt tolerance by removing sodium in exchanger for extracellular protons. In mammals they participate in the regulation of cell pH, volume, and intracellular sodium concentration, as well as for the reabsorption of NaCl across renal, intestinal, and other epithelia [ (PUBMED:16734752) (PUBMED:17071327) (PUBMED:16513813) (PUBMED:11187762) ]. Human NHE is also involved in heart disease, cell growth and in cell differentiation [ (PUBMED:17218973) ]. The removal of intracellular protons in exchange for extracellular sodium effectively eliminates excess acid from actively metabolising cells. In mammalian cells, NHE activity is found in both the plasma membrane and inner mitochondrial membrane. To date, nine mammalian isoforms have been identified (designated NHE1-NHE9) [ (PUBMED:9278382) (PUBMED:9507001) ]. These exchangers are highly-regulated (glyco)phosphoproteins, which, based on their primary structure, appear to contain 10-12 membrane-spanning regions (M) at the N terminus and a large cytoplasmic region at the C terminus. The transmembrane regions M3-M12 share identity with other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the region that is involved in the transport of sodium and hydrogen ions. The cytoplasmic region has little similarity throughout the family. There is some evidence that the exchangers may exist in the cell membrane as homodimers, but little is currently known about the mechanism of their antiport [ (PUBMED:9537504) ].

This entry represents a number of cation/proton exchangers, including Na+/H+ exchangers, K+/H+ exchangers and Na+(K+,Li+,Rb+)/H+ exchangers.

GO process:cation transport (GO:0006812), transmembrane transport (GO:0055085)
GO component:integral component of membrane (GO:0016021)
GO function:solute:proton antiporter activity (GO:0015299)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_H_Exchanger