The domain within your query sequence starts at position 1 and ends at position 130; the E-value for the Na_K-ATPase domain shown below is 1.3e-44.

YSTGQPCVFIKMNRVINFYAGANQSMNVTCVGKRPQHYRDKGRLIPKDGRDEDAENLGHF
VMFPANGSIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDER
DKFAGRVAFK

Na_K-ATPase

• PFAM accession number: PF00287
• Interpro abstract (IPR000402):

  This entry represents the sodium/potassium-transporting ATPase subunit beta. This is the non-catalytic component of the active enzyme, which catalyses the hydrolysis of ATP coupled with the exchange of Na ⁺ and K ⁺ ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane [ (PUBMED:9648860) ].

• GO process: sodium ion transport (GO:0006814), potassium ion transport (GO:0006813)
• GO component: sodium:potassium-exchanging ATPase complex (GO:0005890)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_K-ATPase