The domain within your query sequence starts at position 110 and ends at position 253; the E-value for the Na_Pi_cotrans domain shown below is 1.2e-33.
LFVCSLDVLSSAFQLVGGKVAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTSSSIIVS MVASSLLTVRAAIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVF VLLPLEAATHYLEILTNLVLETFK
Na_Pi_cotrans |
![]() |
---|
PFAM accession number: | PF02690 |
---|---|
Interpro abstract (IPR003841): | This family consists of sodium-dependent phosphate transport proteins of the solute carrier family SLC34A [ (PUBMED:12750889) ]. It includes mammalian type II renal Na+/Pi-cotransporters and other proteins from lower eukaryotes and bacteria, some of which are also Na+/Pi-cotransporters. In kidneys these proteins may be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane [ (PUBMED:8327470) ]. |
GO process: | sodium-dependent phosphate transport (GO:0044341) |
GO component: | membrane (GO:0016020) |
GO function: | sodium:phosphate symporter activity (GO:0005436) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_Pi_cotrans