The domain within your query sequence starts at position 504 and ends at position 626; the E-value for the Na_trans_cytopl domain shown below is 2e-42.
KKRRQREHLEGNHRPEGDRFPKSESEDSVKRRSFLFSLDGNPLSGDKKLCSPHQSLLSIR GSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHSTFEDSESRRDSLFVPHRPGERRNS NGT
Na_trans_cytopl |
![]() |
---|
PFAM accession number: | PF11933 |
---|---|
Interpro abstract (IPR024583): | This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_trans_cytopl