The domain within your query sequence starts at position 321 and ends at position 485; the E-value for the Nab1 domain shown below is 4.4e-55.
GERDELSPKRIKIEDGFPDFQESVPTLFQQARAKSEELAGLGSQQAEKGMAKQMELLCAQ AGYERLQQERRLTAGLYRQSSGEQSPDGGLPSDSSDGQGERPLNLRIPSVQNRQPHHFVV DGELSRLYSSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDS
Nab1 |
---|
PFAM accession number: | PF04902 |
---|---|
Interpro abstract (IPR006986): | Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of eukaryotic (metazoa) transcription factors [ (PUBMED:9418898) ]. This C-terminal region is found only in the Nab1 subfamily. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
GO function: | transcription coregulator activity (GO:0003712) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nab1