The domain within your query sequence starts at position 19 and ends at position 77; the E-value for the Nbl1_Borealin_N domain shown below is 1.5e-25.
RKLASFLKDFDREVQVRTKQIESDRQTLLKEVENLYNIEILRLPKALQGMKWLDYFALG
Nbl1_Borealin_N |
 |
|---|
| PFAM accession number: | PF10444 |
|---|---|
| Interpro abstract (IPR018851): | This entry represents the N-terminal domain of borealin, a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis [ (PUBMED:15249581) (PUBMED:23175282) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nbl1_Borealin_N