The domain within your query sequence starts at position 99 and ends at position 187; the E-value for the Neurexophilin domain shown below is 2.1e-11.

FQTHSSTTSAKQSTATIHNPQRTYCVGDQLNVLLVAKDYFGNRKEYGGDFLRARMSSPAL
KAGASGKVTDFNNGTYLISFTLFWEGPVS

Neurexophilin

Neurexophilin
PFAM accession number:PF06312
Interpro abstract (IPR026845):

This entry includes neurexophilin and NXPE proteins.

Neurexophilins form a family of related glycoproteins that are proteolytically processed after synthesis and bind to alpha-neurexins. The structure and characteristics of neurexophilins indicate that they function as neuropeptides that may signal via alpha-neurexins [ (PUBMED:9570794) ].

NXPE is a glycoprotein with unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neurexophilin