The domain within your query sequence starts at position 60 and ends at position 120; the E-value for the Neuropep_like domain shown below is 2.2e-43.
TLLLLLLSLALLGARAEPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTET L
Neuropep_like |
 |
|---|
| PFAM accession number: | PF15161 |
|---|---|
| Interpro abstract (IPR028147): | This family contains putative neuropeptides [ (PUBMED:21287218) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neuropep_like