The domain within your query sequence starts at position 8 and ends at position 77; the E-value for the Nop52 domain shown below is 1.9e-25.
SEFQFAQRLASSEKGVRDRAVRKLRQYLSARTQSDTGSFSQEELLKIWKGLFYCMWVQDE PLLQVTQSPR
Nop52 |
![]() |
---|
PFAM accession number: | PF05997 |
---|---|
Interpro abstract (IPR010301): | Nop52 is believed to be involved in the generation of 28S rRNA [ (PUBMED:10341208) ]. |
GO process: | rRNA processing (GO:0006364) |
GO component: | preribosome, small subunit precursor (GO:0030688) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop52