The domain within your query sequence starts at position 75 and ends at position 460; the E-value for the Nramp domain shown below is 1.5e-119.
IESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRILL WLTIELAIVGSDMQEVIGTAISFNLLSAGRIPLWDGVLITIVDTFFFLFLDNYGLRKLEA FFGLLITIMALTFGYEYVVAHPSQGALLKGLVLPTCPGCGQPELLQAVGIVGAIIMPHNI YLHSALVKSREVDRTRRVDVREANMYFLIEATIALSVSFIINLFVMAVFGQAFYQQTNEE AFNICANSSLQNYAKIFPRDNNTVSVDIYQGGVILGCLFGPAALYIWAVGLLAAGQSSTM TGTYAGQFVMEGFLKLRWSRFARVLLTRSCAILPTVLVAVFRDLKDLSGLNDLLNVLQSL LLPFAVLPILTFTSMPAVMQEFANGR
Nramp |
![]() |
---|
PFAM accession number: | PF01566 |
---|---|
Interpro abstract (IPR001046): | The natural resistance-associated macrophage protein (NRAMP) family consists of Nramp1, Nramp2, and yeast proteins Smf1 and Smf2. The NRAMP family is a novel family of functionally related proteins defined by a conserved hydrophobic core of ten transmembrane domains [ (PUBMED:7479731) ]. Nramp1 is an integral membrane protein expressed exclusively in cells of the immune system and is recruited to the membrane of a phagosome upon phagocytosis. Nramp2 is a multiple divalent cation transporter for Fe2+, Mn2+ and Zn2+ amongst others. It is expressed at high levels in the intestine; and is major transferrin-independent iron uptake system in mammals [ (PUBMED:9719491) ]. The yeast proteins Smf1 and Smf2 may also transport divalent cations [ (PUBMED:9632246) ]. The natural resistance of mice to infection with intracellular parasites is controlled by the Bcg locus, which modulates the cytostatic/cytocidal activity of phagocytes. Nramp1, the gene responsible, is expressed exclusively in macrophages and poly-morphonuclear leukocytes, and encodes a polypeptide (natural resistance-associated macrophage protein) with features typical of integral membrane proteins. Other transporter proteins from a variety of sources also belong to this family. |
GO process: | metal ion transport (GO:0030001) |
GO component: | membrane (GO:0016020) |
GO function: | metal ion transmembrane transporter activity (GO:0046873) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nramp