The domain within your query sequence starts at position 317 and ends at position 433; the E-value for the Nsp1_C domain shown below is 2.3e-43.
LPASSTAAGTATGPAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKI TSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHADEE
Nsp1_C |
![]() |
---|
PFAM accession number: | PF05064 |
---|---|
Interpro abstract (IPR007758): | The NSP1-like protein appears to be an essential component of the nuclear pore complex, for example preribosome nuclear export requires the Nup82p-Nup159p-Nsp1p complex. The C-terminal of Nsp1 is involved in binding Nup82 [ (PUBMED:11689687) ], probably via coiled-coil formation [ (PUBMED:11689687) (PUBMED:17037504) ]. The family is related to the rotavirus nonstructural protein NSP1 which is the least conserved protein in the rotavirus genome. Its function in the replication process is not fully understood. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nsp1_C