The domain within your query sequence starts at position 115 and ends at position 224; the E-value for the NtCtMGAM_N domain shown below is 1.2e-35.
GLKATLSRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKLTDPNNKRYEVPHQFVKDGNGIP AADTLYDVKVSENPFSIKVIRKSNNKVLFDTSIGPLVYSNQYLQISTRLP
NtCtMGAM_N |
![]() |
---|
PFAM accession number: | PF16863 |
---|---|
Interpro abstract (IPR031727): | This is a beta-barrel-like structure just N-terminal to the catalytic domain of maltase-glucoamylase in eukaryotes. It contributes to the architecture of the substrate-binding site by donating a loop that comes into close contact with two regions in the catalytic domain, thereby creating the site [ (PUBMED:18036614) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NtCtMGAM_N