SMART: Pfam domain Nuc_deoxyrib

The domain within your query sequence starts at position 12 and ends at position 144; the E-value for the Nuc_deoxyrib_tr domain shown below is 3.8e-21.

VYFCGSIRGGREDQALYSRIVSRLRRYGKVLTEHVADAELEPRGEEAAGGDQFIHERDLA
WLRQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQV
WDYAEEEVETMLH

Nuc_deoxyrib_tr

PFAM accession number:	PF05014
Interpro abstract (IPR007710):	Nucleoside 2-deoxyribosyltransferase (NDT) ( EC 2.4.2.6 ) catalyses the cleavage of the glycosidic bonds of 2-deoxyribonucleosides. Nucleoside 2-deoxyribosyltransferases can be divided into two groups based on their substrate specificity: class I enzymes are specific for the transfer of deoxyribose between two purines, while class II enzymes will transfer the deoxyribose between either purines or pyrimidines. The structure of the class I [ (PUBMED:14992575) ] and class II [ (PUBMED:8805514) ] enzymes are very similar. In class I enzymes, the purine base shields the active site from solvent, which the smaller pyrimidine base cannot do, while in class II enzymes the active site is shielded by a loop (residues 48-62). Both classes of enzymes are found in various Lactobacillus species and participate in nucleoside recycling in these microorganisms. This entry represents both classes of enzymes. This entry also includes the related enzyme deoxynucleoside 5-monophosphate N-glycosidase (DNPH1), a nucleotide hydrolase ( EC 3.2.2 ). DNPH1 is related to NDT in structure and enzymatic activity, but in contrast to NDT catalyzes the hydrolysis of 2'-deoxyribonucleoside 5'-monophosphate to yield a free nucleobase and 2-deoxyribose 5-phosphate [ (PUBMED:17234634) (PUBMED:29273295) ]. DNPH1 is a potential proto-oncogene [ (PUBMED:11526483) ].

PFAM accession number:

PF05014

Interpro abstract (IPR007710):

Nucleoside 2-deoxyribosyltransferase (NDT) ( EC 2.4.2.6 ) catalyses the cleavage of the glycosidic bonds of 2-deoxyribonucleosides. Nucleoside 2-deoxyribosyltransferases can be divided into two groups based on their substrate specificity: class I enzymes are specific for the transfer of deoxyribose between two purines, while class II enzymes will transfer the deoxyribose between either purines or pyrimidines. The structure of the class I [ (PUBMED:14992575) ] and class II [ (PUBMED:8805514) ] enzymes are very similar. In class I enzymes, the purine base shields the active site from solvent, which the smaller pyrimidine base cannot do, while in class II enzymes the active site is shielded by a loop (residues 48-62). Both classes of enzymes are found in various Lactobacillus species and participate in nucleoside recycling in these microorganisms. This entry represents both classes of enzymes.

This entry also includes the related enzyme deoxynucleoside 5-monophosphate N-glycosidase (DNPH1), a nucleotide hydrolase ( EC 3.2.2 ). DNPH1 is related to NDT in structure and enzymatic activity, but in contrast to NDT catalyzes the hydrolysis of 2'-deoxyribonucleoside 5'-monophosphate to yield a free nucleobase and 2-deoxyribose 5-phosphate [ (PUBMED:17234634) (PUBMED:29273295) ]. DNPH1 is a potential proto-oncogene [ (PUBMED:11526483) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_deoxyrib_tr