The domain within your query sequence starts at position 2 and ends at position 129; the E-value for the Nuc_sug_transp domain shown below is 2.4e-39.
ELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGL MGVYVYDGELVSKNGFFQGYNQLTWIVVALQPQGIGSPSVYHAVIVIFLEFFAWGLLTAP TLVVLHET
Nuc_sug_transp |
---|
PFAM accession number: | PF04142 |
---|---|
Interpro abstract (IPR007271): | This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles. SLC35A1 ( P78382 ) transports CMP-sialic acid, SLC35A2 ( P78381 ) transports UDP-galactose and SLC35A3 ( Q9Y2D2 ) transports UDP-GlcNAc [ (PUBMED:25210595) ]. |
GO process: | pyrimidine nucleotide-sugar transmembrane transport (GO:0090481) |
GO component: | Golgi membrane (GO:0000139), integral component of membrane (GO:0016021) |
GO function: | pyrimidine nucleotide-sugar transmembrane transporter activity (GO:0015165) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_sug_transp