SMART: Pfam domain Nucleoporin

The domain within your query sequence starts at position 593 and ends at position 1052; the E-value for the Nucleoporin_C domain shown below is 1.2e-26.

SLIILHQLEDKMKAHCLLVDFLHQVGLFRRLSSYPIRGTPMSTRLLLCEHAEKLSAAITL
KNHHSRLPDLVNSAILLALNKRECEVPNSLTPADVFFREVSQVDTICECLLEHEEQVLRE
VALVSQEWAEVAIDVNTVLKDMLQAATHYRLNKSSMYSQEEVLGKEPEYVPWTATSGPSG
IRTAVMRQHGIILKMVYPQADSKLRNVVMEQLVALIDCFLDSYVSQLKSLEKSSDQERYS
SLEVEYLQKRSELLSPLLTLGQYPWAASLAEKYCDFDILVQMCEQTDNQARLQRYMTQFA
DQNFSDFLFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHTTL
LGLANMETRYFAKKKTLLGLSKLAALASDISEDRLQEKIEAMAEQERFLLHQETLPEQLL
TERQLSLSAMPVLTAPQLISLYICDENRRANEYDFKKALD

Nucleoporin_C

PFAM accession number:	PF03177
Interpro abstract (IPR007187):	This is the C-terminal half of a family of nucleoporin proteins. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins. Two nucleoporin classes are known: one is characterised by the FG repeat and the other is represented by this family, which lacks any repeats. RNA undergoing nuclear export first encounters the basket of the nuclear pore and many nucleoporins are accessible on the basket side of the pore [ (PUBMED:10191094) (PUBMED:11684705) ].

PFAM accession number:

PF03177

Interpro abstract (IPR007187):

This is the C-terminal half of a family of nucleoporin proteins. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins. Two nucleoporin classes are known: one is characterised by the FG repeat and the other is represented by this family, which lacks any repeats. RNA undergoing nuclear export first encounters the basket of the nuclear pore and many nucleoporins are accessible on the basket side of the pore [ (PUBMED:10191094) (PUBMED:11684705) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleoporin_C