The domain within your query sequence starts at position 246 and ends at position 332; the E-value for the Nucleoporin_FG domain shown below is 2.2e-7.
TNSAFSYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTPNTGFSFGNT STLGQPSTNTMGLFGVTQASQPGGLFG
Nucleoporin_FG |
![]() |
---|
PFAM accession number: | PF13634 |
---|---|
Interpro abstract (IPR025574): | This entry represents a region containing FG repeats that is found in nucleoporin proteins, key elements of the selective gate-barrier that limits the diffusion of cargoes through the NPC [ (PUBMED:17082456) (PUBMED:18228033) ]. It includes the yeast nucleoporins Nup116, Nup100, Nup49, Nup57 and Nup 145. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleoporin_FG