The domain within your query sequence starts at position 221 and ends at position 292; the E-value for the Nucleos_tra2_N domain shown below is 3.5e-27.
GLIMYLILLFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTRPGFVAFDWMGRQVQTFLG YTDTGARFVFGE
Nucleos_tra2_N |
---|
PFAM accession number: | PF01773 |
---|---|
Interpro abstract (IPR002668): | The concentrative nucleoside transporter (CNT) (TC 2.A.41) family includes Q62773 which is a purine-specific Na + -nucleoside cotransporter localised to the bile canalicular membrane [ (PUBMED:7775409) ]. It also includes Q62674 a Na + -dependent nucleoside transporter selective for pyrimidine nucleosides and adenosine, which also transports the anti-viral nucleoside analogues AZT and ddC [ (PUBMED:8027026) ]. This domain lies towards the N terminus of this family of transporters. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleos_tra2_N