SMART: Pfam domain NupH

The domain within your query sequence starts at position 2 and ends at position 286; the E-value for the NupH_GANP domain shown below is 3.3e-108.

HPVNPFGGQQPSAFAVSSSTTGTYQTKSPFRFGQPSLFGQNSTPSKSLAFSQVPSFATPS
GGSHSSSLPAFGLTQTSSVGLFSSLESTPSFAATSSSSVPGNTAFSFKSTSSVGVFPSGA
TFGPETGEVAGSGFRKTEFKFKPLENAVFKPIPGPESEPEKTQSQISSGFFTFSHPVGSG
SGGLTPFSFPQVTNSSVTSSSFIFSKPVTSNTPAFASPLSNQNVEEEKRVSTSAFGSSNS
SFSTFPTASPGSLGEPFPANKPSLRQGCEEAISQVEPLPTLMKGL

NupH_GANP

PFAM accession number:	PF16768
Interpro abstract (IPR031908):	This entry represents the nucleoporin-homology domain at the N terminus of human GANP or germinal-centre associated nuclear proteins (GANP). GANP is involved in the nuclear export of poly(A)-containing mRNAs by acting as a scaffold for the TREX-2 complex. This domain binds to export factor NXF1. Through this interaction, GANP facilitates the transfer of NXF1-containing mRNPs (messenger ribonucleoproteins) to nuclear pore complexes [ (PUBMED:22307388) ].

PFAM accession number:

PF16768

Interpro abstract (IPR031908):

This entry represents the nucleoporin-homology domain at the N terminus of human GANP or germinal-centre associated nuclear proteins (GANP). GANP is involved in the nuclear export of poly(A)-containing mRNAs by acting as a scaffold for the TREX-2 complex. This domain binds to export factor NXF1. Through this interaction, GANP facilitates the transfer of NXF1-containing mRNPs (messenger ribonucleoproteins) to nuclear pore complexes [ (PUBMED:22307388) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NupH_GANP