The domain within your query sequence starts at position 960 and ends at position 1076; the E-value for the OB_NTP_bind domain shown below is 5e-13.
VQLKEILINSGFPEDCLLTQVFTNTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEG RNALIHKSSVNCPFSSQDMKYPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKK
OB_NTP_bind |
![]() |
---|
PFAM accession number: | PF07717 |
---|---|
Interpro abstract (IPR011709): | This domain is found towards the C terminus of the DEAD-box helicases ( IPR011545 ). In these helicases it appears to be always found in association with IPR007502 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OB_NTP_bind