The domain within your query sequence starts at position 25 and ends at position 134; the E-value for the OGG_N domain shown below is 1.2e-27.
SIPCPRSELRLDLVLASGQSFRWKEQSPAHWSGVLADQVWTLTQTEDQLYCTVYRGDDSQ VSRPTLEELETLHKYFQLDVSLAQLYSHWASVDSHFQRVAQKFQGLWTST
OGG_N |
 |
|---|
| PFAM accession number: | PF07934 |
|---|---|
| Interpro abstract (IPR012904): | The presence of 8-oxoguanine residues in DNA can give rise to G-C to T-A transversion mutations. This enzyme is found in archaeal, bacterial and eukaryotic species, and is specifically responsible for the process which leads to the removal of 8-oxoguanine residues. It has DNA glycosylase activity ( EC 3.2.2.23 ) and DNA lyase activity ( EC 4.2.99.18 ) [ (PUBMED:10706276) ]. The region featured in this family is the N-terminal domain, which is organised into a single copy of a TBP-like fold. The domain contributes residues to the 8-oxoguanine binding pocket [ (PUBMED:11902834) ]. |
| GO process: | nucleotide-excision repair (GO:0006289) |
| GO function: | damaged DNA binding (GO:0003684), oxidized purine nucleobase lesion DNA N-glycosylase activity (GO:0008534) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OGG_N