The domain within your query sequence starts at position 177 and ends at position 431; the E-value for the ORC5_C domain shown below is 5.1e-68.
LYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKY CEPVVKGEAGERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDNTDPGQLKGLSA YTHMELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKP FPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTIVGHEDQLNGPKYKCTVSLDFI RAIARMVNFDIIKYL
ORC5_C |
![]() |
---|
PFAM accession number: | PF14630 |
---|---|
Interpro abstract (IPR020796): | The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [ (PUBMED:17241905) ]. ORC is a central component for eukaryotic DNA replication, and binds chromatin at replication origins throughout the cell cycle [ (PUBMED:17825065) ]. ORC directs DNA replication throughout the genome and is required for its initiation [ (PUBMED:1579162) (PUBMED:7585959) (PUBMED:16716188) ]. ORC bound at replication origins serves as the foundation for assembly of the pre-replicative complex (pre-RC), which includes Cdc6, Tah11 (aka Cdt1), and the Mcm2-7 complex [ (PUBMED:7892251) (PUBMED:7781615) (PUBMED:16228006) ]. Pre-RC assembly during G1 is required for replication licensing of chromosomes prior to DNA synthesis during S phase [ (PUBMED:10966477) (PUBMED:12045100) (PUBMED:15680967) ]. Cell cycle-regulated phosphorylation of ORC2, ORC6, Cdc6, and MCM by the cyclin-dependent protein kinase Cdc28 regulates initiation of DNA replication, including blocking reinitiation in G2/M phase [ (PUBMED:17825065) (PUBMED:11572976) (PUBMED:11429609) (PUBMED:16024805) ]. In yeast, ORC also plays a role in the establishment of silencing at the mating-type loci Hidden MAT Left (HML) and Hidden MAT Right (HMR) [ (PUBMED:1579162) (PUBMED:7585959) (PUBMED:16716188) ]. ORC participates in the assembly of transcriptionally silent chromatin at HML and HMR by recruiting the Sir1 silencing protein to the HML and HMR silencers [ (PUBMED:16716188) (PUBMED:8622770) (PUBMED:9171055) ]. Both ORC1 and ORC5 bind ATP, although only ORC1 has ATPase activity [ (PUBMED:9038340) ]. The binding of ATP by ORC1 is required for ORC binding to DNA and is essential for cell viability [ (PUBMED:16228006) ]. The ATPase activity of ORC1 is involved in formation of the pre-RC [ (PUBMED:11459976) (PUBMED:15610739) (PUBMED:16387651) ]. ATP binding by ORC5 is crucial for the stability of ORC as a whole. Only the ORC1-5 subunits are required for origin binding; ORC6 is essential for maintenance of pre-RCs once formed [ (PUBMED:17053779) ]. Interactions within ORC suggest that ORC2-3-6 may form a core complex [ (PUBMED:17825065) ]. ORC homologues have been found in various eukaryotes, including fission yeast, insects, amphibians, and humans [ (PUBMED:9442876) ]. |
GO process: | DNA replication (GO:0006260) |
GO component: | nucleus (GO:0005634), origin recognition complex (GO:0000808) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ORC5_C