The domain within your query sequence starts at position 494 and ends at position 595; the E-value for the Occludin_ELL domain shown below is 6.4e-36.
YPAISSSEQRQSYKNDFNAEYSEYRSLHARIEQITRRFTQLDAQLRQLSQGSDEYETTRG QILQEYRKIKKTNTNYSCEKRRCEYLHRKLAHIKRLIAEYDQ
Occludin_ELL |
---|
PFAM accession number: | PF07303 |
---|---|
Interpro abstract (IPR010844): | This represents a conserved region approximately 100 residues long within eukaryotic occludin proteins and the RNA polymerase II elongation factor ELL. Occludin is an integral membrane protein that localises to tight junctions [ (PUBMED:8276896) ], while ELL is an elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA [ (PUBMED:8596958) ]. This shared domain is thought to mediate protein interactions [ (PUBMED:8276896) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Occludin_ELL