The domain within your query sequence starts at position 1 and ends at position 397; the E-value for the Ocular_alb domain shown below is 4.1e-227.
MASPRLGIFCCPTWDAATQLVLSFQPRVFHALCLGSGTLRLVLGLLQLLSGRRSVGHRAP ATSPAASVHILRAATACDLLGCLGIVIRSTVWIAYPEFIENISNVNATDIWPATFCVGSA MWIQLLYSACFWWLFCYAVDVYLVIRRSAGRSTILLYHIMAWGLAVLLCVEGAVMLYYPS VSRCERGLDHAIPHYVTTYLPLLLVLVANPILFHKTVTSVASLLKGRKGVYTENERLMGA VIKTRFFKIMLVLIACWLSNIINESLLFYLEMQPDIHGGSLKRIQNAARTTWFIMGILNP AQGLLLSLAFYGWTGCSLDVHPPKMVIQWETMTASAAEGTYQTPVRSCVPHQNPRKVVCV GGHTSDEVLSILSEDSDASTVEIHTATGSCNIKEVDS
Ocular_alb |
---|
PFAM accession number: | PF02101 |
---|---|
Interpro abstract (IPR001414): | G-protein coupled receptor 143 (also known as ocular albinism type 1, OA1) is a receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, it stimulates Ca2+ influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalises beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells [ (PUBMED:1869779) ]. Ocular albinism type 1 is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes. A novel transcript from the OA1 critical region is expressed in high levels in RNA samples from retina and from melanoma and encodes a potential integral membrane protein [ (PUBMED:7647783) ]. |
GO process: | G protein-coupled receptor signaling pathway (GO:0007186) |
GO component: | membrane (GO:0016020) |
GO function: | tyrosine binding (GO:0072545), G protein-coupled receptor activity (GO:0004930), dopamine binding (GO:0035240), L-DOPA binding (GO:0072544) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ocular_alb