The domain within your query sequence starts at position 48 and ends at position 282; the E-value for the Orthopox_A5L domain shown below is 6.5e-9.
DFPNSGREENEATHSVLRSENERLKKLYTDLEEKHEASELQIKQQSSSYRSQLQQKEEEI NHLKARQLALQDELLRLQSAAQSAHLGSGSAPAASASSSFSYGVSHRVSAFHEDDMDFGD VISSQQEINRLSNEVSRLESELGHWRHIAQTKVQGAQSSDQTEICKLQNIIKELKQNRSQ DLDDHQHELSALQNAHQQKLTEISRRHREEWLRSYDAENEIMRLRSLNQDISLAE
Orthopox_A5L |
---|
PFAM accession number: | PF06193 |
---|---|
Interpro abstract (IPR010396): | This family consists of several Orthopoxvirus A5L proteins. The vaccinia virus WR A5L open reading frame (corresponding to open reading frame A4L in vaccinia virus Copenhagen) encodes an immunodominant late protein found in the core of the vaccinia virion. The A5 protein appears to be required for the immature virion to form the brick-shaped intracellular mature virion [ (PUBMED:10233918) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Orthopox_A5L