The domain within your query sequence starts at position 20 and ends at position 152; the E-value for the Osteopontin domain shown below is 1.2e-60.

KVTDSGSSEEKKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSN
ESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTV
DVPNGRGDSLAYG

Osteopontin

Osteopontin
PFAM accession number:PF00865
Interpro abstract (IPR002038):

The major event of endochondrial ossification is the proteolytic degradation of calcified cartilage and the extracellular matrix, and their substitution with bone-specific extracellular matrix produced and organised by osteoblasts [ (PUBMED:2033080) ]. One of the most abundant products of osteoblasts is osteopontin, a glycosylated phosphoprotein with a high acidic amino acid content and one copy of the cell attachment sequence RGD [ (PUBMED:2033080) ]. It is thought that osteopontin may act as a bridge between osteoblasts and the apatite mineral of the bone [ (PUBMED:2033080) ]. Osteopontin-K is a kidney protein, similar to osteopontin and probably also involved in cell adhesion [ (PUBMED:1414488) ].

GO process:cell adhesion (GO:0007155), ossification (GO:0001503)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Osteopontin