The domain within your query sequence starts at position 29 and ends at position 192; the E-value for the Osteoregulin domain shown below is 4.2e-76.
NEDRSSCGNQDSIHKDLAASVYPDPTVDEGTEDGQGALLHPPGQDRYGAALLRNITQPVK SLVTGAELRREGNQEKRPQSVLSVIPADVNDAKVSLKDIKNQESYLLTQSSPVKSKHTKH TRQTRRSTHYLTHLPQIKKTPSDLEGSGSPDLLVRGDNDVPPFS
Osteoregulin |
![]() |
---|
PFAM accession number: | PF07175 |
---|---|
Interpro abstract (IPR009837): | This family represents a conserved region approximately 180 residues long within osteoregulin, a bone-remodelling protein expressed highly in osteocytes within trabecular and cortical bone. A conserved RGD motif is found towards the C-terminal end of this region, and this is potentially involved in integrin recognition [ (PUBMED:10967096) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Osteoregulin