The domain within your query sequence starts at position 14 and ends at position 56; the E-value for the Oxidored-like domain shown below is 3.9e-15.

LRLKPVEPLPSQCCGSGCSPCVFDLYYRDLERWETARARNDRS

Oxidored-like

Oxidored-like
PFAM accession number:PF09791
Interpro abstract (IPR019180):

This entry represents the N-terminal domain of various oxidoreductase-like proteins whose exact function is, as yet, unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Oxidored-like