The domain within your query sequence starts at position 874 and ends at position 1019; the E-value for the OxoGdeHyase_C domain shown below is 8.3e-54.
KSSFDQMVSGTSFQRLIPEDGPAAHSPEQVQRLIFCTGKVYYDLVKERSSQGLEQQVAIT RLEQISPFPFDLIMREAEKYSGAELVWCQEEHKNMGYYDYISPRFMTLLGHSRPIWYVGR DPAAAPATGNKNAHLVSLRRFLDTAF
OxoGdeHyase_C |
![]() |
---|
PFAM accession number: | PF16870 |
---|---|
Interpro abstract (IPR031717): | This domain is found immediately C-terminal to the transketolase-like pyrimidine-binding domain ( IPR005475 ). It is found at the C terminus of multifunctional 2-oxoglutarate metabolism enzyme Kgd [ (PUBMED:21867916) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OxoGdeHyase_C